eF-site ID 2gc4-L PDB Code 2gc4 Chain L click to enlarge Title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution. Classification Oxidoreductase, Electron transport Compound Methylamine dehydrogenase heavy chain Source ORGANISM_SCIENTIFIC: Paracoccus denitrificans; Sequence L:  APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYN EDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTY PGNETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWV RHLYTGDPKDASWLTDEQKAGFTPFQP Description Functional site 1) chain L residue 72 type sequence G description BINDING SITE FOR RESIDUE NA L 601 source : AC5 2) chain L residue 75 type sequence D description BINDING SITE FOR RESIDUE NA L 601 source : AC5 3) chain L residue 77 type sequence Y description BINDING SITE FOR RESIDUE NA L 601 source : AC5 4) chain L residue 56 type sequence M description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 5) chain L residue 57 type sequence C description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 6) chain L residue 60 type sequence C description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 7) chain L residue 61 type sequence H description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 8) chain L residue 71 type sequence P description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 9) chain L residue 73 type sequence L description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 10) chain L residue 78 type sequence W description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 11) chain L residue 79 type sequence T description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 12) chain L residue 80 type sequence Y description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 13) chain L residue 83 type sequence N description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 14) chain L residue 89 type sequence L description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 15) chain L residue 97 type sequence A description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 16) chain L residue 98 type sequence T description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 17) chain L residue 100 type sequence Q description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 18) chain L residue 101 type sequence M description BINDING SITE FOR RESIDUE HEC L 200 source : BC1 19) chain L residue 57 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 20) chain L residue 60 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 21) chain L residue 61 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links