eF-site ID 2gc4-H PDB Code 2gc4 Chain H click to enlarge Title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution. Classification Oxidoreductase, Electron transport Compound Methylamine dehydrogenase heavy chain Source ORGANISM_SCIENTIFIC: Paracoccus denitrificans; Sequence H:  APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYN EDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTY PGNETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWV RHLYTGDPKDASWLTDEQKAGFTPFQP Description Functional site 1) chain H residue 72 type sequence G description BINDING SITE FOR RESIDUE NA H 603 source : AC7 2) chain H residue 75 type sequence D description BINDING SITE FOR RESIDUE NA H 603 source : AC7 3) chain H residue 77 type sequence Y description BINDING SITE FOR RESIDUE NA H 603 source : AC7 4) chain H residue 56 type sequence M description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 5) chain H residue 57 type sequence C description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 6) chain H residue 60 type sequence C description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 7) chain H residue 61 type sequence H description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 8) chain H residue 71 type sequence P description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 9) chain H residue 73 type sequence L description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 10) chain H residue 78 type sequence W description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 11) chain H residue 79 type sequence T description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 12) chain H residue 80 type sequence Y description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 13) chain H residue 83 type sequence N description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 14) chain H residue 89 type sequence L description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 15) chain H residue 93 type sequence L description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 16) chain H residue 97 type sequence A description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 17) chain H residue 98 type sequence T description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 18) chain H residue 100 type sequence Q description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 19) chain H residue 101 type sequence M description BINDING SITE FOR RESIDUE HEC H 200 source : AC9 20) chain H residue 57 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 21) chain H residue 60 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 22) chain H residue 61 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links