eF-site ID 2gc4-D PDB Code 2gc4 Chain D click to enlarge Title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution. Classification Oxidoreductase, Electron transport Compound Methylamine dehydrogenase heavy chain Source ORGANISM_SCIENTIFIC: Paracoccus denitrificans; Sequence D:  APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYN EDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTY PGNETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWV RHLYTGDPKDASWLTDEQKAGFTPFQP Description Functional site 1) chain D residue 72 type sequence G description BINDING SITE FOR RESIDUE NA D 604 source : AC8 2) chain D residue 75 type sequence D description BINDING SITE FOR RESIDUE NA D 604 source : AC8 3) chain D residue 77 type sequence Y description BINDING SITE FOR RESIDUE NA D 604 source : AC8 4) chain D residue 56 type sequence M description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 5) chain D residue 57 type sequence C description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 6) chain D residue 60 type sequence C description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 7) chain D residue 61 type sequence H description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 8) chain D residue 71 type sequence P description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 9) chain D residue 73 type sequence L description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 10) chain D residue 78 type sequence W description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 11) chain D residue 79 type sequence T description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 12) chain D residue 80 type sequence Y description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 13) chain D residue 83 type sequence N description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 14) chain D residue 89 type sequence L description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 15) chain D residue 93 type sequence L description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 16) chain D residue 97 type sequence A description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 17) chain D residue 98 type sequence T description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 18) chain D residue 100 type sequence Q description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 19) chain D residue 101 type sequence M description BINDING SITE FOR RESIDUE HEC D 200 source : BC2 20) chain D residue 61 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 21) chain D residue 57 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 22) chain D residue 60 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1

Display surface Download Links