eF-site ID 2gc4-B PDB Code 2gc4 Chain B click to enlarge Title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution. Classification Oxidoreductase, Electron transport Compound Methylamine dehydrogenase heavy chain Source ORGANISM_SCIENTIFIC: Paracoccus denitrificans; Sequence B:  TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNC PPGTKLATASXVASCYNPTDGQSYLIAYRDCCGYNVSGRC PCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPI VGKAS Description Functional site 1) chain B residue 32 type catalytic sequence D description 13 source MCSA : MCSA1 2) chain B residue 57 type catalytic sequence X description 13 source MCSA : MCSA1 3) chain B residue 76 type catalytic sequence D description 13 source MCSA : MCSA1 4) chain B residue 108 type catalytic sequence W description 13 source MCSA : MCSA1 5) chain B residue 119 type catalytic sequence Y description 13 source MCSA : MCSA1 6) chain B residue 122 type catalytic sequence T description 13 source MCSA : MCSA1

Display surface Download Links