eF-site ID 2g7b-A PDB Code 2g7b Chain A click to enlarge Title Crystal Structure of the R132K:R111L:L121E mutant of Cellular Retinoic Acid Binding Protein Type II In Complex With All-Trans-Retinal At 1.18 Angstroms Resolution Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPA VEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELI ETMTADDVVCTKVYVRE Description Functional site 1) chain A residue 48 type sequence D description BINDING SITE FOR RESIDUE NA A 300 source : AC1 2) chain A residue 26 type sequence V description BINDING SITE FOR RESIDUE NA A 301 source : AC2 3) chain A residue 68 type sequence G description BINDING SITE FOR RESIDUE NA A 301 source : AC2 4) chain A residue 115 type sequence N description BINDING SITE FOR RESIDUE NA A 301 source : AC2 5) chain A residue 13 type sequence E description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 6) chain A residue 15 type sequence F description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 7) chain A residue 28 type sequence L description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 8) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 9) chain A residue 59 type sequence R description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 10) chain A residue 76 type sequence V description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 11) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 12) chain A residue 123 type sequence M description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 13) chain A residue 131 type sequence T description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 14) chain A residue 132 type sequence K description BINDING SITE FOR RESIDUE AZE A 138 source : AC3 15) chain A residue 133 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214 17) chain A residue 102 type CROSSLNK sequence G description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links