eF-site ID 2g5z-A
PDB Code 2g5z
Chain A

click to enlarge
Title Structure of S65G Y66S GFP variant after spontaneous peptide hydrolysis and decarboxylation
Classification LUMINESCENT PROTEIN
Compound Green fluorescent protein
Source Aequorea victoria (Jellyfish) (GFP_AEQVI)
Sequence A:  KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLKFICTTGKLPVPWPTLVTTFX
Description (1)  Green fluorescent protein

Display surface

Download
Links