eF-site ID 2g2f-AC PDB Code 2g2f Chain A, C click to enlarge Title A Src-like Inactive Conformation in the Abl Tyrosine Kinase Domain Classification TRANSFERASE Compound Abl Kinase Source Homo sapiens (Human) (2G2F) Sequence A:  YDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVK TLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPF YIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAM EYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGD TYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWE IATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYEL MRACWQWNPSDRPSFAEIHQAFETMFQESSISDEV C:  EAIFAAPF Description Functional site 1) chain A residue 248 type sequence L description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 2) chain A residue 250 type sequence G description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 3) chain A residue 251 type sequence G description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 4) chain A residue 252 type sequence Q description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 5) chain A residue 256 type sequence V description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 6) chain A residue 269 type sequence A description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 7) chain A residue 271 type sequence K description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 8) chain A residue 315 type sequence T description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 9) chain A residue 316 type sequence E description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 10) chain A residue 317 type sequence F description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 11) chain A residue 318 type sequence M description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 12) chain A residue 322 type sequence N description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 13) chain A residue 363 type sequence D description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 14) chain C residue 107 type sequence F description BINDING SITE FOR RESIDUE 112 C 201 source : AC2 15) chain A residue 446 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P00520 source Swiss-Prot : SWS_FT_FI6 16) chain A residue 393 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis and SRC-type Tyr-kinases => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI5 17) chain A residue 248-271 type prosite sequence LGGGQYGEVYEGVWKKYSLTVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGGGQYGEVYeGvwkkyslt..........VAVK source prosite : PS00107 18) chain A residue 359-371 type prosite sequence FIHRDLAARNCLV description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FIHrDLAARNCLV source prosite : PS00109 19) chain A residue 363 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 248 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 271 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 316 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 253 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 24) chain A residue 257 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 413 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links