eF-site ID 2fzu-A
PDB Code 2fzu
Chain A

click to enlarge
Title Reduced enolate chromophore intermediate for GFP variant
Classification LUMINESCENT PROTEIN
Compound Green fluorescent protein
Source Aequorea victoria (Jellyfish) (GFP_AEQVI)
Sequence A:  KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFF
KSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIE
LKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKAN
FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQ
SALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Description (1)  Green fluorescent protein


Functional site

1) chain A
residue 11
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EDO A 303
source : AC2

2) chain A
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE EDO A 303
source : AC2

3) chain A
residue 36
type
ligand
sequence D
description BINDING SITE FOR RESIDUE EDO A 303
source : AC2

4) chain A
residue 41
type
ligand
sequence K
description BINDING SITE FOR RESIDUE EDO A 303
source : AC2

5) chain A
residue 43
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 303
source : AC2


Display surface

Download
Links