eF-site ID 2ft7-A PDB Code 2ft7 Chain A click to enlarge Title Structure of Cu(I)azurin at pH 6, with the metal-binding loop sequence "CTFPGHSALM" replaced with "CTPHPM" Classification ELECTRON TRANSPORT Compound Azurin Source Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (AZUR_PSEAE) Sequence A:  CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKN VMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIA HTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPHPMKGTLT LK Description (1)  Azurin Functional site 1) chain A residue 45 type sequence G description BINDING SITE FOR RESIDUE CU1 A 200 source : AC1 2) chain A residue 46 type sequence H description BINDING SITE FOR RESIDUE CU1 A 200 source : AC1 3) chain A residue 112 type sequence C description BINDING SITE FOR RESIDUE CU1 A 200 source : AC1 4) chain A residue 115 type sequence H description BINDING SITE FOR RESIDUE CU1 A 200 source : AC1 5) chain A residue 117 type sequence M description BINDING SITE FOR RESIDUE CU1 A 200 source : AC1 6) chain A residue 46 type BINDING sequence H description BINDING => ECO:0000269|PubMed:1420141 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 112 type BINDING sequence C description BINDING => ECO:0000269|PubMed:1420141 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 117 type BINDING sequence M description BINDING => ECO:0000269|PubMed:1420141 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 121 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links