eF-site ID 2fr3-A PDB Code 2fr3 Chain A click to enlarge Title Crystal Structure of Cellular Retinoic Acid Binding Protein Type II in Complex with All-Trans-Retinoic Acid at 1.48 Angstroms Resolution Classification TRANSPORT PROTEIN Compound Cellular retinoic acid binding protein 2 Source null (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPA VEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI LTMTADDVVCTRVYVRE Description Functional site 1) chain A residue 12 type sequence S description BINDING SITE FOR RESIDUE ACT A 500 source : AC1 2) chain A residue 13 type sequence E description BINDING SITE FOR RESIDUE ACT A 500 source : AC1 3) chain A residue 14 type sequence N description BINDING SITE FOR RESIDUE ACT A 500 source : AC1 4) chain A residue 15 type sequence F description BINDING SITE FOR RESIDUE ACT A 500 source : AC1 5) chain A residue 16 type sequence E description BINDING SITE FOR RESIDUE ACT A 500 source : AC1 6) chain A residue 11 type sequence R description BINDING SITE FOR RESIDUE REA A 300 source : AC2 7) chain A residue 13 type sequence E description BINDING SITE FOR RESIDUE REA A 300 source : AC2 8) chain A residue 19 type sequence L description BINDING SITE FOR RESIDUE REA A 300 source : AC2 9) chain A residue 32 type sequence A description BINDING SITE FOR RESIDUE REA A 300 source : AC2 10) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE REA A 300 source : AC2 11) chain A residue 58 type sequence V description BINDING SITE FOR RESIDUE REA A 300 source : AC2 12) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE REA A 300 source : AC2 13) chain A residue 132 type sequence R description BINDING SITE FOR RESIDUE REA A 300 source : AC2 14) chain A residue 134 type sequence Y description BINDING SITE FOR RESIDUE REA A 300 source : AC2 15) chain A residue 133 type BINDING sequence V description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214 17) chain A residue 102 type CROSSLNK sequence G description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links