eF-site ID 2fqp-D PDB Code 2fqp Chain D click to enlarge Title Crystal structure of a cupin domain (bp2299) from bordetella pertussis tohama i at 1.80 A resolution Classification METAL BINDING PROTEIN Compound hypothetical protein BP2299 Source (NP_880937) Sequence D:  RPGAIPTVQIDNERVKVTEWRFPPGGETGWHRHSXDYVVV PXTTGPLLLETPEGSVTSQLTRGVSYTRPEGVEHNVINPS DTEFVFVEIEIKAA Description Functional site 1) chain D residue 33 type sequence H description BINDING SITE FOR RESIDUE ZN D 100 source : AC4 2) chain D residue 35 type sequence H description BINDING SITE FOR RESIDUE ZN D 100 source : AC4 3) chain D residue 76 type sequence H description BINDING SITE FOR RESIDUE ZN D 100 source : AC4 4) chain D residue 39 type sequence Y description BINDING SITE FOR RESIDUE ACT D 101 source : AC8 5) chain D residue 68 type sequence Y description BINDING SITE FOR RESIDUE ACT D 101 source : AC8 6) chain D residue 70 type sequence R description BINDING SITE FOR RESIDUE ACT D 101 source : AC8 7) chain D residue 76 type sequence H description BINDING SITE FOR RESIDUE ACT D 101 source : AC8 8) chain D residue 88 type sequence F description BINDING SITE FOR RESIDUE ACT D 101 source : AC8

Display surface Download Links