eF-site ID 2fpe-E PDB Code 2fpe Chain E click to enlarge Title Conserved dimerization of the ib1 src-homology 3 domain Classification SIGNALING PROTEIN Compound C-jun-amino-terminal kinase interacting protein 1 Source Rattus norvegicus (Rat) (JIP1_RAT) Sequence E:  EQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAY NXRTGARGVFPAYYAIEV Description Functional site 1) chain E residue 14 type sequence H description BINDING SITE FOR RESIDUE SO4 E 701 source : AC1 2) chain E residue 15 type sequence E description BINDING SITE FOR RESIDUE SO4 E 701 source : AC1 3) chain E residue 5 type sequence R description BINDING SITE FOR RESIDUE SO4 E 707 source : AC6 4) chain E residue 25 type sequence P description BINDING SITE FOR RESIDUE SO4 E 707 source : AC6 5) chain E residue 53 type sequence Y description BINDING SITE FOR RESIDUE P6G A 802 source : AC9 6) chain E residue 55 type sequence A description BINDING SITE FOR RESIDUE P6G A 802 source : AC9 7) chain E residue 35 type sequence Y description BINDING SITE FOR RESIDUE SO2 F 805 source : BC2 8) chain E residue 35 type sequence Y description BINDING SITE FOR RESIDUE SO2 F 805 source : BC2

Display surface Download Links