eF-site ID 2fpe-A PDB Code 2fpe Chain A click to enlarge Title Conserved dimerization of the ib1 src-homology 3 domain Classification SIGNALING PROTEIN Compound C-jun-amino-terminal kinase interacting protein 1 Source Rattus norvegicus (Rat) (JIP1_RAT) Sequence A:  GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYE AYNXRTGARGVFPAYYAIEVTK Description Functional site 1) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 704 source : AC4 2) chain A residue 5 type sequence R description BINDING SITE FOR RESIDUE SO4 A 704 source : AC4 3) chain A residue 25 type sequence P description BINDING SITE FOR RESIDUE SO4 A 704 source : AC4 4) chain A residue 9 type sequence R description BINDING SITE FOR RESIDUE SO4 A 708 source : AC7 5) chain A residue 7 type sequence I description BINDING SITE FOR RESIDUE P6G A 802 source : AC9 6) chain A residue 53 type sequence Y description BINDING SITE FOR RESIDUE P6G A 802 source : AC9 7) chain A residue 55 type sequence A description BINDING SITE FOR RESIDUE P6G A 802 source : AC9

Display surface Download Links