eF-site ID 2fnt-A PDB Code 2fnt Chain A click to enlarge Title Crystal structure of a drug-resistant (V82A) inactive (D25N) HIV-1 protease complexed with AP2V variant of HIV-1 NC-p1 substrate. Classification HYDROLASE Compound protease Source (2FNT) Sequence A:  PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPG KWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT PANIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE PO4 B 501 source : AC1 2) chain A residue 7 type sequence K description BINDING SITE FOR RESIDUE ACT A 504 source : AC3 3) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ACT A 504 source : AC3 4) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE PO4 A 505 source : AC4 5) chain A residue 21 type sequence E description BINDING SITE FOR RESIDUE PO4 A 505 source : AC4 6) chain A residue 83 type sequence N description BINDING SITE FOR RESIDUE PO4 A 505 source : AC4 7) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE PO4 A 506 source : AC5 8) chain A residue 51 type sequence G description BINDING SITE FOR RESIDUE PO4 A 506 source : AC5 9) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE PO4 A 507 source : AC6 10) chain A residue 63 type sequence P description BINDING SITE FOR RESIDUE PO4 A 507 source : AC6 11) chain A residue 58 type sequence Q description BINDING SITE FOR RESIDUE ACT A 510 source : AC9 12) chain A residue 25 type ACT_SITE sequence N description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links