eF-site ID 2fne-B
PDB Code 2fne
Chain B

click to enlarge
Title The crystal structure of the 13th PDZ domain of MPDZ
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Multiple PDZ domain protein
Source Homo sapiens (Human) (MPDZ_HUMAN)
Sequence B:  LYFQSMPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYV
KTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAI
LKRTKGTVTLMVLSSDETSV
Description (1)  Multiple PDZ domain protein

Display surface

Download
Links