eF-site ID 2fne-A
PDB Code 2fne
Chain A

click to enlarge
Title The crystal structure of the 13th PDZ domain of MPDZ
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Multiple PDZ domain protein
Source Homo sapiens (Human) (MPDZ_HUMAN)
Sequence A:  MPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFA
KGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTK
GTVTLMVLSSDETSV
Description (1)  Multiple PDZ domain protein

Display surface

Download
Links