eF-site ID 2ffq-A PDB Code 2ffq Chain A click to enlarge Title The crystal structure of human neuronal Rab6B in its active GTPgS-bound form Classification HYDROLASE Compound Ras-related protein Rab-6B Source Homo sapiens (Human) (RAB6B_HUMAN) Sequence A:  KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLS KTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVV YDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLAD KRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVAS ALLE Description Functional site 1) chain A residue 27 type sequence T description BINDING SITE FOR RESIDUE MG A 356 source : AC1 2) chain A residue 45 type sequence T description BINDING SITE FOR RESIDUE MG A 356 source : AC1 3) chain A residue 22 type sequence Q description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 4) chain A residue 23 type sequence S description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 5) chain A residue 24 type sequence V description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 6) chain A residue 25 type sequence G description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 7) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 8) chain A residue 27 type sequence T description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 9) chain A residue 28 type sequence S description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 10) chain A residue 38 type sequence F description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 11) chain A residue 39 type sequence D description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 12) chain A residue 40 type sequence N description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 13) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 14) chain A residue 45 type sequence T description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 15) chain A residue 71 type sequence G description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 16) chain A residue 113 type sequence T description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 17) chain A residue 126 type sequence N description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 18) chain A residue 127 type sequence K description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 19) chain A residue 129 type sequence D description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 20) chain A residue 130 type sequence L description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 21) chain A residue 156 type sequence S description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 22) chain A residue 157 type sequence A description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 23) chain A residue 158 type sequence K description BINDING SITE FOR RESIDUE GSP A 355 source : AC2 24) chain A residue 20 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 45 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 68 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 126 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 82 type MOD_RES sequence Y description O-AMP-tyrosine; by Legionella DrrA => ECO:0000269|PubMed:21822290 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links