eF-site ID 2fe5-A PDB Code 2fe5 Chain A click to enlarge Title The Crystal Structure of the Second PDZ Domain of Human DLG3 Classification STRUCTURAL PROTEIN Compound Presynaptic protein SAP102 Source Homo sapiens (Human) (DLG3_HUMAN) Sequence A:  SMTIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKI IEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKN TSDMVYLKVAKPGS Description Functional site 1) chain A residue 228 type sequence N description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 2) chain A residue 247 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 3) chain A residue 253 type sequence N description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 4) chain A residue 271 type sequence R description BINDING SITE FOR RESIDUE SO4 A 501 source : AC1 5) chain A residue 231 type sequence K description BINDING SITE FOR RESIDUE GOL A 401 source : AC2 6) chain A residue 234 type sequence K description BINDING SITE FOR RESIDUE GOL A 401 source : AC2 7) chain A residue 235 type sequence G description BINDING SITE FOR RESIDUE GOL A 401 source : AC2 8) chain A residue 236 type sequence L description BINDING SITE FOR RESIDUE GOL A 401 source : AC2 9) chain A residue 237 type sequence G description BINDING SITE FOR RESIDUE GOL A 401 source : AC2 10) chain A residue 299 type sequence K description BINDING SITE FOR RESIDUE GOL A 401 source : AC2

Display surface Download Links