eF-site ID 2fd3-B
PDB Code 2fd3
Chain B

click to enlarge
Title Crystal Structure of Thioredoxin Mutant P34H
Classification ELECTRON TRANSPORT
Compound Thioredoxin 1
Source Escherichia coli (strain K12) (THIO_ECOLI)
Sequence B:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAP
ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
Description (1)  Thioredoxin 1


Functional site

1) chain B
residue 32
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI4

2) chain B
residue 35
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI4

3) chain B
residue 33
type SITE
ligand
sequence G
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI5

4) chain B
residue 34
type SITE
ligand
sequence H
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI5

5) chain B
residue 26
type SITE
ligand
sequence D
description Deprotonates C-terminal active site Cys.
source Swiss-Prot : SWS_FT_FI6

6) chain B
residue 24-42
type prosite
ligand
sequence LVDFWAEWCGHCKMIAPIL
description Thioredoxin family active site. [LIVMF]-[LIVMSTA]-x-[LIVMFYC]-[FYWSTHE]-x(2)-[FYWGTN]-C-[GATPLVE]
source prosite : PS00194

7) chain B
residue 34
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

8) chain B
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

9) chain B
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

10) chain B
residue 33
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

11) chain B
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA4

12) chain B
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA4


Display surface

Download
Links