eF-site ID 2fd3-AB
PDB Code 2fd3
Chain A, B

click to enlarge
Title Crystal Structure of Thioredoxin Mutant P34H
Classification ELECTRON TRANSPORT
Compound Thioredoxin 1
Source Escherichia coli (strain K12) (THIO_ECOLI)
Sequence A:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAP
ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
B:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAP
ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL
FKNGEVAATKVGALSKGQLKEFLDANLA
Description (1)  Thioredoxin 1


Functional site

1) chain A
residue 32
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 35
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 33
type SITE
ligand
sequence G
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI2

4) chain A
residue 34
type SITE
ligand
sequence H
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI2

5) chain A
residue 26
type SITE
ligand
sequence D
description Deprotonates C-terminal active site Cys.
source Swiss-Prot : SWS_FT_FI3

6) chain B
residue 32
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI4

7) chain B
residue 35
type ACT_SITE
ligand
sequence C
description Nucleophile.
source Swiss-Prot : SWS_FT_FI4

8) chain B
residue 33
type SITE
ligand
sequence G
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI5

9) chain B
residue 34
type SITE
ligand
sequence H
description Contributes to redox potential value.
source Swiss-Prot : SWS_FT_FI5

10) chain B
residue 26
type SITE
ligand
sequence D
description Deprotonates C-terminal active site Cys.
source Swiss-Prot : SWS_FT_FI6

11) chain A
residue 36
type catalytic
ligand
sequence K
description Mapped from 1mek to 2fd3 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 96264879
source extCATRES : extCATRES1

12) chain A
residue 39
type catalytic
ligand
sequence A
description Mapped from 1mek to 2fd3 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 96264879
source extCATRES : extCATRES1

13) chain A
residue 37
type catalytic
ligand
sequence M
description Mapped from 1mek to 2fd3 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 96264879
source extCATRES : extCATRES1

14) chain A
residue 38
type catalytic
ligand
sequence I
description Mapped from 1mek to 2fd3 using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 96264879
source extCATRES : extCATRES1

15) chain A
residue 24-42
type prosite
ligand
sequence LVDFWAEWCGHCKMIAPIL
description Thioredoxin family active site. [LIVMF]-[LIVMSTA]-x-[LIVMFYC]-[FYWSTHE]-x(2)-[FYWGTN]-C-[GATPLVE]
source prosite : PS00194

16) chain B
residue 24-42
type prosite
ligand
sequence LVDFWAEWCGHCKMIAPIL
description Thioredoxin family active site. [LIVMF]-[LIVMSTA]-x-[LIVMFYC]-[FYWSTHE]-x(2)-[FYWGTN]-C-[GATPLVE]
source prosite : PS00194

17) chain A
residue 34
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1mek
source CSA : CSA1

18) chain A
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA1

19) chain A
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA1

20) chain A
residue 33
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1mek
source CSA : CSA1

21) chain B
residue 34
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

22) chain B
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

23) chain B
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

24) chain B
residue 33
type catalytic
ligand
sequence G
description Annotated By Reference To The Literature 1mek
source CSA : CSA2

25) chain A
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA3

26) chain A
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA3

27) chain B
residue 35
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA4

28) chain B
residue 32
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 1mek
source CSA : CSA4


Display surface

Download
Links