eF-site ID 2fd3-AB PDB Code 2fd3 Chain A, B click to enlarge Title Crystal Structure of Thioredoxin Mutant P34H Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source null (THIO_ECOLI) Sequence A:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAP ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA B:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAP ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 2) chain B residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 3) chain A residue 24-42 type prosite sequence LVDFWAEWCGHCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGHCKmIapiL source prosite : PS00194 4) chain A residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain A residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain B residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain B residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 9) chain B residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 10) chain A residue 34 type SITE sequence H description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 11) chain A residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 12) chain B residue 34 type SITE sequence H description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 13) chain B residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3

Display surface Download Links