eF-site ID 2fcn-AB PDB Code 2fcn Chain A, B click to enlarge Title X-ray Crystal Structure of a Chemically Synthesized [D-Val35]Ubiquitin with a Cubic Space Group Classification STRUCTURAL PROTEIN Compound Ubiquitin Source (AAH14880) Sequence A:  LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEXIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL B:  LQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEXIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL Description Functional site 1) chain A residue 64 type sequence E description BINDING SITE FOR RESIDUE CD A 100 source : AC1 2) chain A residue 68 type sequence H description BINDING SITE FOR RESIDUE CD A 100 source : AC1 3) chain A residue 46 type sequence A description BINDING SITE FOR RESIDUE ACT A 101 source : AC2 4) chain A residue 47 type sequence G description BINDING SITE FOR RESIDUE ACT A 101 source : AC2 5) chain A residue 63 type sequence K description BINDING SITE FOR RESIDUE ACT A 101 source : AC2 6) chain A residue 64 type sequence E description BINDING SITE FOR RESIDUE ACT A 101 source : AC2 7) chain A residue 68 type sequence H description BINDING SITE FOR RESIDUE ACT A 101 source : AC2 8) chain A residue 64 type sequence E description BINDING SITE FOR RESIDUE ACT A 102 source : AC3 9) chain A residue 18 type sequence E description BINDING SITE FOR RESIDUE CD A 200 source : AC4 10) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE CD A 200 source : AC4 11) chain A residue 29 type sequence K description BINDING SITE FOR RESIDUE CD A 200 source : AC4 12) chain A residue 1 type sequence L description BINDING SITE FOR RESIDUE CD A 300 source : AC5 13) chain A residue 16 type sequence E description BINDING SITE FOR RESIDUE CD A 300 source : AC5 14) chain A residue 32 type sequence D description BINDING SITE FOR RESIDUE CD A 300 source : AC5 15) chain A residue 1 type sequence L description BINDING SITE FOR RESIDUE ACT A 301 source : AC6 16) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE ACT A 301 source : AC6 17) chain A residue 16 type sequence E description BINDING SITE FOR RESIDUE ACT A 301 source : AC6 18) chain A residue 32 type sequence D description BINDING SITE FOR RESIDUE ACT A 301 source : AC6 19) chain A residue 24 type sequence E description BINDING SITE FOR RESIDUE CD A 400 source : AC7 20) chain A residue 52 type sequence D description BINDING SITE FOR RESIDUE CD A 400 source : AC7 21) chain A residue 39 type sequence D description BINDING SITE FOR RESIDUE CD A 401 source : AC8 22) chain A residue 58 type sequence D description BINDING SITE FOR RESIDUE CD A 402 source : AC9 23) chain B residue 68 type sequence H description BINDING SITE FOR RESIDUE CD B 500 source : BC1 24) chain B residue 18 type sequence E description BINDING SITE FOR RESIDUE CD B 600 source : BC2 25) chain B residue 18 type sequence E description BINDING SITE FOR RESIDUE CD B 600 source : BC2 26) chain B residue 21 type sequence D description BINDING SITE FOR RESIDUE CD B 600 source : BC2 27) chain B residue 29 type sequence K description BINDING SITE FOR RESIDUE CD B 600 source : BC2 28) chain B residue 1 type sequence L description BINDING SITE FOR RESIDUE CD B 700 source : BC3 29) chain B residue 16 type sequence E description BINDING SITE FOR RESIDUE CD B 700 source : BC3 30) chain B residue 24 type sequence E description BINDING SITE FOR RESIDUE CD B 800 source : BC4 31) chain B residue 52 type sequence D description BINDING SITE FOR RESIDUE CD B 800 source : BC4 32) chain B residue 39 type sequence D description BINDING SITE FOR RESIDUE CD B 801 source : BC5 33) chain B residue 58 type sequence D description BINDING SITE FOR RESIDUE CD B 802 source : BC6 34) chain A residue 27-52 type prosite sequence KAKIQDKEXIPPDQQRLIFAGKQLED description UBIQUITIN_1 Ubiquitin domain signature. KakIqDkevIPpdqQrLIFaGkqleD source prosite : PS00299

Display surface Download Links