eF-site ID 2fch-E PDB Code 2fch Chain E click to enlarge Title Crystal Structure of Thioredoxin Mutant G74S Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence E:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRSIPTLLLF KNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain E residue 60 type sequence I description BINDING SITE FOR RESIDUE MPD E 502 source : AC2 2) chain E residue 67 type sequence A description BINDING SITE FOR RESIDUE MPD E 502 source : AC2 3) chain E residue 73 type sequence R description BINDING SITE FOR RESIDUE MPD E 502 source : AC2 4) chain E residue 74 type sequence S description BINDING SITE FOR RESIDUE MPD E 502 source : AC2 5) chain E residue 70 type sequence Y description BINDING SITE FOR RESIDUE MPD E 503 source : AC3 6) chain E residue 71 type sequence G description BINDING SITE FOR RESIDUE MPD E 503 source : AC3 7) chain E residue 89 type sequence T description BINDING SITE FOR RESIDUE MPD E 503 source : AC3 8) chain E residue 36 type sequence K description BINDING SITE FOR RESIDUE MPD D 506 source : AC6 9) chain E residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 10) chain E residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 11) chain E residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 12) chain E residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 13) chain E residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 14) chain E residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3

Display surface Download Links