eF-site ID 2fch-A PDB Code 2fch Chain A click to enlarge Title Crystal Structure of Thioredoxin Mutant G74S Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source null (THIO_ECOLI) Sequence A:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRSIPTLLLF KNGEVAATKVGALSKGQLKEFLDANL Description Functional site 1) chain A residue 70 type sequence Y description BINDING SITE FOR RESIDUE MPD E 503 source : AC3 2) chain A residue 89 type sequence T description BINDING SITE FOR RESIDUE MPD E 503 source : AC3 3) chain A residue 72 type sequence I description BINDING SITE FOR RESIDUE MPD A 507 source : AC7 4) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194 6) chain A residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain A residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 9) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 10) chain A residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3

Display surface Download Links