eF-site ID 2f58-L
PDB Code 2f58
Chain L

click to enlarge
Title IGG1 FAB FRAGMENT (58.2) COMPLEX WITH 12-RESIDUE CYCLIC PEPTIDE (INCLUDING RESIDUES 315-324 OF HIV-1 GP120) (MN ISOLATE)
Classification IMMUNE SYSTEM
Compound PROTEIN (IGG1 FAB 58.2 ANTIBODY (LIGHT CHAIN))
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence L:  DIVLTQSPASLAVSLGQRATISCKASQGVDFDGASFMNWY
QQKPGQPPKLLIFAASTLESGIPARFSGRGSGTDFTLNIH
PVEEEDAATYYCQQSHEDPLTFGAGTKLELKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQ
NGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRA
Description (1)  PROTEIN (IGG1 FAB 58.2 ANTIBODY (LIGHT AND HEAVY CHAINS))

Display surface

Download
Links