eF-site ID 2f3i_18-A
PDB Code 2f3i
Model 18
Chain A

click to enlarge
Title Solution Structure of a Subunit of RNA Polymerase II
Classification TRANSFERASE
Compound DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide
Source Homo sapiens (Human) (RPB8_HUMAN)
Sequence A:  MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLI
LDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Description (1)  DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide (E.C.2.7.7.6)

Display surface

Download
Links