eF-site ID 2ewf-A
PDB Code 2ewf
Chain A

click to enlarge
Title Crystal structure of the site-specific DNA nickase N.BspD6I
Classification HYDROLASE
Compound Nicking endonuclease N.BspD6I
Source Bacillus sp (Q8GCA3_BACSP)
Sequence A:  MAKKVNWYVSCSPRSPEKIQPELKVLANFEGSYWKGVKGY
KAQEAFAKELAALPQFLGAFSTRDRVAPMKTYGFVFVDEE
GYLRITEAGKMLANNRRPKDVFLKQLVKWQYPSFQHKGKE
YPEEEWSINPLVFVLSLLKKVGGLSKLDIAMFCLTATNNN
QVDEIAEEIMQFRNEREKIKGQNKKLEFTENYFFKRFEKI
YGNVSHKSKIETKMRNARDVADATTRYFRYTGLFVARGNQ
LVLNPEKSDLIDEIISSSKVVKNYTRVEEFHEYYGNPSLP
QFSFETKEQLLDLAHRIRDENTRLAEQLVEHFPNVKVEIQ
VLEDIYNSLNKKVDVETLKDVIYHAKELQLELKKKKLQAD
FNDPRQLEEVIDLLEVYHEKKNVIEEKIKARFIANKNTVF
EWLTWNGFIILGNALEYKNNFVIDEELQPVTHAAGNQPDM
EIIYEDFIVLGEVTTSKGATQFKMESEPVTRHYLNKKKEL
EKQGVEKELYCLFIAPEINKNTFEEFMKYNIVQNTRIIPL
SLKQFNMLLMVQKKLIEKGRRLSSYDIKNLMVSLYRTTIE
CERKYTQIKAGLEETLNNWVVDKEVRF
Description (1)  Nicking endonuclease N.BspD6I


Functional site

1) chain A
residue 190
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BR A 605
source : AC1

2) chain A
residue 191
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BR A 605
source : AC1

3) chain A
residue 286
type
ligand
sequence E
description BINDING SITE FOR RESIDUE BR A 605
source : AC1

4) chain A
residue 54
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BR A 606
source : AC2

5) chain A
residue 55
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE BR A 606
source : AC2

6) chain A
residue 75
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BR A 607
source : AC3

7) chain A
residue 78
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BR A 607
source : AC3

8) chain A
residue 413
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BR A 608
source : AC4

9) chain A
residue 243
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BR A 609
source : AC5

10) chain A
residue 415
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BR A 609
source : AC5

11) chain A
residue 449
type
ligand
sequence H
description BINDING SITE FOR RESIDUE BR A 609
source : AC5

12) chain A
residue 84
type
ligand
sequence V
description BINDING SITE FOR RESIDUE BR A 610
source : AC6

13) chain A
residue 122
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE BR A 610
source : AC6

14) chain A
residue 401
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BR A 611
source : AC7

15) chain A
residue 413
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BR A 611
source : AC7

16) chain A
residue 34
type
ligand
sequence W
description BINDING SITE FOR RESIDUE BR A 612
source : AC8

17) chain A
residue 330
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BR A 613
source : AC9

18) chain A
residue 331
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BR A 613
source : AC9

19) chain A
residue 247
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BR A 614
source : BC1

20) chain A
residue 440
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BR A 614
source : BC1

21) chain A
residue 183
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BR A 617
source : BC2

22) chain A
residue 184
type
ligand
sequence E
description BINDING SITE FOR RESIDUE BR A 617
source : BC2


Display surface

Download
Links