eF-site ID 2erc-A PDB Code 2erc Chain A click to enlarge Title CRYSTAL STRUCTURE OF ERMC' A RRNA-METHYL TRANSFERASE Classification METHYLTRANSFERASE Compound RRNA METHYL TRANSFERASE Source null (ERM_BACSU) Sequence A:  QNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELV QRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFK FPKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVEY GFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKV NSSLIRLNRKKSRISHKDKQKYNYFVMKWVNKEYKKIFTK NQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK Description Functional site 1) chain A residue 34-61 type prosite sequence IFEIGSGKGHFTLELVQRCNFVTAIEID description RRNA_A_DIMETH Ribosomal RNA adenine dimethylases signature. IFEiGSGkGhFTlelVqrcnf...VtAIEiD source prosite : PS01131 2) chain A residue 38 type catalytic sequence G description 898 source MCSA : MCSA1 3) chain A residue 59 type catalytic sequence E description 898 source MCSA : MCSA1 4) chain A residue 101 type catalytic sequence N description 898 source MCSA : MCSA1 5) chain A residue 104 type catalytic sequence Y description 898 source MCSA : MCSA1 6) chain A residue 163 type catalytic sequence F description 898 source MCSA : MCSA1 7) chain A residue 13 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 8) chain A residue 38 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 9) chain A residue 59 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 10) chain A residue 84 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 101 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links