eF-site ID 2ep8_11-A
PDB Code 2ep8
Model 11
Chain A

click to enlarge
Title Solution structure of the BRCT domain from human Pescadillo homolog 1
Classification CELL CYCLE
Compound Pescadillo homolog 1
Source Homo sapiens (Human) (PESC_HUMAN)
Sequence A:  GSSGSSGKHKKLFEGLKFFLNREVPREALAFIIRSFGGEV
SWDKSLCIGATYDVTDSRITHQIVDRPGQQTSVIGRCYVQ
PQWVFDSVNARLLLPVAEYF
Description (1)  Pescadillo homolog 1

Display surface

Download
Links