eF-site ID 2eio-ABCD PDB Code 2eio Chain A, B, C, D click to enlarge Title Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence A:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKCFLDANLA B:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKCFLDANLA C:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKCFLDANLA D:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKCFLDANLA Description Functional site 1) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194 2) chain A residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 3) chain A residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 4) chain B residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain B residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain C residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain C residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain D residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 9) chain D residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 10) chain A residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 11) chain B residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 12) chain C residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 13) chain D residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 14) chain A residue 33 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 15) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 16) chain B residue 33 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 17) chain B residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 18) chain C residue 33 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 19) chain C residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 20) chain D residue 33 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 21) chain D residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 22) chain A residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 23) chain B residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 24) chain C residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 25) chain D residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links