eF-site ID 2ei2-A PDB Code 2ei2 Chain A click to enlarge Title Crystal Structure Analysis of the 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. stain C18 Classification OXIDOREDUCTASE Compound 1,2-dihydroxynaphthalene dioxygenase Source Pseudomonas sp. (strain C18) (NAHC_PSEU8) Sequence A:  NAAVIELGYMGISVKDPDAWKSFATDMLGLQVLDEGEKDR FYLRMDYWHHRIVVHHNGQDDLEYLGWRVAGKPEFEALGQ KLIDAGYKIRICDKVEAQERMVLGLMKTEDPGGNPTEIFW GPRIDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVAEA HKFYSLLGFRGDVEYRIPLPNGMTAELSFMHCNARDHSIA FGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQ LGIHANDKALTFYGATPSGWLIEPGWRGATAIDEAEYYVG DIFGHGVEATGYGLDVKLS Description Functional site 1) chain A residue 177 type sequence E description BINDING SITE FOR RESIDUE MG A 398 source : AC1 2) chain A residue 152 type sequence H description BINDING SITE FOR RESIDUE FE2 A 399 source : AC2 3) chain A residue 215 type sequence H description BINDING SITE FOR RESIDUE FE2 A 399 source : AC2 4) chain A residue 256 type sequence Y description BINDING SITE FOR RESIDUE FE2 A 399 source : AC2 5) chain A residue 266 type sequence E description BINDING SITE FOR RESIDUE FE2 A 399 source : AC2 6) chain A residue 12 type sequence Y description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 7) chain A residue 51 type sequence W description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 8) chain A residue 52 type sequence H description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 9) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 10) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 11) chain A residue 104 type sequence M description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 12) chain A residue 125 type sequence P description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 13) chain A residue 126 type sequence R description BINDING SITE FOR RESIDUE GOL A 901 source : AC3 14) chain A residue 192 type sequence F description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 15) chain A residue 247 type sequence H description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 16) chain A residue 256 type sequence Y description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 17) chain A residue 297 type sequence L description BINDING SITE FOR RESIDUE GOL A 902 source : AC4 18) chain A residue 245-266 type prosite sequence GIHANDKALTFYGATPSGWLIE description EXTRADIOL_DIOXYGENAS Extradiol ring-cleavage dioxygenases signature. GiHandkaltFYgaTPsGwliE source prosite : PS00082 19) chain A residue 152 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 20) chain A residue 199 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 21) chain A residue 215 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 22) chain A residue 256 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 266 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links