eF-site ID 2eb8-A PDB Code 2eb8 Chain A click to enlarge Title Crystal Structure of Cu(II)(Sal-Phe)/apo-Myoglobin Classification OXYGEN STORAGE/TRANSPORT Compound Myoglobin Source Physeter macrocephalus (Sperm whale) (Physeter catodon) (MYG_PHYCA) Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET LEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG Description Functional site 1) chain A residue 45 type sequence R description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 2) chain A residue 63 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 3) chain A residue 93 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 4) chain A residue 116 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 5) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2002 source : AC2 6) chain A residue 119 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2002 source : AC2 7) chain A residue 45 type sequence R description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 8) chain A residue 63 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 9) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 10) chain A residue 67 type sequence T description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 11) chain A residue 87 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 12) chain A residue 92 type sequence S description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 13) chain A residue 148 type sequence E description BINDING SITE FOR RESIDUE PO4 A 2003 source : AC3 14) chain A residue 113 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2004 source : AC4 15) chain A residue 117 type sequence S description BINDING SITE FOR RESIDUE PO4 A 2004 source : AC4 16) chain A residue 93 type sequence H description BINDING SITE FOR RESIDUE PO4 A 2005 source : AC5 17) chain A residue 147 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2005 source : AC5 18) chain A residue 43 type sequence F description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 19) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 20) chain A residue 68 type sequence V description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 21) chain A residue 91 type sequence Q description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 22) chain A residue 92 type sequence S description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 23) chain A residue 95 type sequence T description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 24) chain A residue 99 type sequence I description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 25) chain A residue 104 type sequence L description BINDING SITE FOR RESIDUE CUP A 1001 source : AC6 26) chain A residue 64 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:7463482, ECO:0007744|PDB:1MBO source Swiss-Prot : SWS_FT_FI1 27) chain A residue 67 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P04247 source Swiss-Prot : SWS_FT_FI4 28) chain A residue 3 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q9QZ76 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 93 type BINDING sequence H description proximal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959, ECO:0007744|PDB:4MBN, ECO:0007744|PDB:5MBN source Swiss-Prot : SWS_FT_FI2

Display surface Download Links