eF-site ID 2e6w-A
PDB Code 2e6w
Chain A

click to enlarge
Title Solution structure and calcium binding properties of EF-hands 3 and 4 of calsenilin
Classification METAL BINDING PROTEIN
Compound Calsenilin
Source Homo sapiens (Human) (CSEN_HUMAN)
Sequence A:  GTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGR
HTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ
KDENIMSSMQLFENVI
Description (1)  Calsenilin


Functional site

1) chain A
residue 175
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 300
source : AC1

2) chain A
residue 177
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 300
source : AC1

3) chain A
residue 179
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 300
source : AC1

4) chain A
residue 181
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CA A 300
source : AC1

5) chain A
residue 186
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CA A 300
source : AC1

6) chain A
residue 223
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

7) chain A
residue 225
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

8) chain A
residue 227
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

9) chain A
residue 229
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

10) chain A
residue 231
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

11) chain A
residue 234
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CA A 301
source : AC2

12) chain A
residue 175-187
type prosite
ligand
sequence DINKDGYITKEEM
description EF-hand calcium-binding domain. D-{W}-[DNS]-{ILVFYW}-[DENSTG]-[DNQGHRK]-{GP}-[LIVMC]-[DENQSTAGC]-x(2)
source prosite : PS00018

13) chain A
residue 223-235
type prosite
ligand
sequence DRNQDGVVTIEEF
description EF-hand calcium-binding domain. D-{W}-[DNS]-{ILVFYW}-[DENSTG]-[DNQGHRK]-{GP}-[LIVMC]-[DENQSTAGC]-x(2)
source prosite : PS00018


Display surface

Download
Links