eF-site ID 2e2j-I PDB Code 2e2j Chain I click to enlarge Title RNA polymerase II elongation complex in 5 mM Mg+2 with GMPCPP Classification TRANSCRIPTION,TRANSFERASE/DNA-RNA HYBRID Compound 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3' Source ORGANISM_COMMON: baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence I:  TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSP LVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSR ENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ Description Functional site 1) chain I residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN I 203 source : AC5 2) chain I residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN I 203 source : AC5 3) chain I residue 29 type sequence C description BINDING SITE FOR RESIDUE ZN I 203 source : AC5 4) chain I residue 31 type sequence T description BINDING SITE FOR RESIDUE ZN I 203 source : AC5 5) chain I residue 32 type sequence C description BINDING SITE FOR RESIDUE ZN I 203 source : AC5 6) chain I residue 75 type sequence C description BINDING SITE FOR RESIDUE ZN I 204 source : AC6 7) chain I residue 78 type sequence C description BINDING SITE FOR RESIDUE ZN I 204 source : AC6 8) chain I residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN I 204 source : AC6 9) chain I residue 106 type sequence C description BINDING SITE FOR RESIDUE ZN I 204 source : AC6 10) chain I residue 75-110 type prosite sequence CPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIF description ZF_TFIIS_1 Zinc finger TFIIS-type signature. CpkChsrenvffqSQQRRkDTSmvlffvCls...CshiF source prosite : PS00466 11) chain I residue 6-32 type prosite sequence FCRDCNNMLYPREDKENNRLLFECRTC description RNA_POL_M_15KD RNA polymerases M / 15 Kd subunits signature. FCRDCNNMLypredkennrllfeCrtC source prosite : PS01030 12) chain I residue 10 type MOD_RES sequence C description Phosphoserine => ECO:0007744|PubMed:17330950, ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI3 13) chain I residue 32 type MOD_RES sequence C description Phosphoserine => ECO:0007744|PubMed:17330950, ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI3 14) chain I residue 78 type CROSSLNK sequence C description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:32142654, ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI4 15) chain I residue 103 type CROSSLNK sequence C description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:32142654, ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI4 16) chain I residue 106 type CROSSLNK sequence C description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:32142654, ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI4 17) chain I residue 40 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links