eF-site ID 2dwc-A PDB Code 2dwc Chain A click to enlarge Title Crystal structure of Probable phosphoribosylglycinamide formyl transferase from Pyrococcus horikoshii OT3 complexed with ADP Classification TRANSFERASE Compound 433aa long hypothetical phosphoribosylglycinamide formyl transferase Source Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (O58056_PYRHO) Sequence A:  VVMIKLRDELGTATTDSAQKILLLGSGELGKEIAIEAQRL GVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVERE KPDAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHR ERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHT KAIMSYFVKGPEDIPKAWEEEKIIVEEHIDFDVEVTELAV RHFDENGEIVTTFPKPVGHYQIDGDYHASWQPAEISEKAE REVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRP HDTGMVTLASHPPGFSEFALHLRAVLGLPIPGEWVDGYRL FPMLIPAATHVIKAKVSGYSPRFRGLVKALSVPNATVRLF GKPEAYVGRRLGIALAWDKDVEVAKRKAEMVAHMIELRTR SSDWHD Description Functional site 1) chain A residue 414 type sequence R description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 2) chain A residue 420 type sequence W description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 3) chain A residue 378 type sequence K description BINDING SITE FOR RESIDUE SO4 A 604 source : AC4 4) chain A residue 382 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 604 source : AC4 5) chain A residue 385 type sequence R description BINDING SITE FOR RESIDUE SO4 A 604 source : AC4 6) chain A residue 121 type sequence R description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 7) chain A residue 160 type sequence H description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 8) chain A residue 162 type sequence K description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 9) chain A residue 202 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 10) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 11) chain A residue 204 type sequence H description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 12) chain A residue 205 type sequence I description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 13) chain A residue 207 type sequence F description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 14) chain A residue 210 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 15) chain A residue 237 type sequence Q description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 16) chain A residue 281 type sequence F description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 17) chain A residue 290 type sequence N description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 18) chain A residue 291 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : AC5 19) chain A residue 29 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 89 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 279 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 291 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 298 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 378 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 385 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_01643 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 121 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_01643, ECO:0000269|Ref.3 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 162 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_01643, ECO:0000269|Ref.3 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 202 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643, ECO:0000269|Ref.3 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 210 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_01643, ECO:0000269|Ref.3 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links