eF-site ID 2dva-C
PDB Code 2dva
Chain C

click to enlarge
Title Crystal structure of peanut lectin GAL-BETA-1,3-GALNAC-ALPHA-O-ME (Methyl-T-antigen) complex
Classification SUGAR BINDING PROTEIN
Compound Galactose-binding lectin
Source ORGANISM_COMMON: peanut; ORGANISM_SCIENTIFIC: Arachis hypogaea;
Sequence C:  AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKV
NSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYD
PADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGV
EFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAV
VKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPE
RVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Description (1)  Galactose-binding lectin


Functional site

1) chain C
residue 80
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

2) chain C
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

3) chain C
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

4) chain C
residue 104
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

5) chain C
residue 125
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

6) chain C
residue 127
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

7) chain C
residue 211
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

8) chain C
residue 214
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL C 239
source : AC5

9) chain C
residue 211
type
ligand
sequence S
description BINDING SITE FOR RESIDUE MGC C 240
source : AC6

10) chain C
residue 212
type
ligand
sequence L
description BINDING SITE FOR RESIDUE MGC C 240
source : AC6

11) chain C
residue 213
type
ligand
sequence G
description BINDING SITE FOR RESIDUE MGC C 240
source : AC6

12) chain C
residue 123
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 237
source : BC4

13) chain C
residue 125
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE CA C 237
source : BC4

14) chain C
residue 127
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA C 237
source : BC4

15) chain C
residue 132
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C 237
source : BC4

16) chain C
residue 121
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 238
source : BC5

17) chain C
residue 123
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 238
source : BC5

18) chain C
residue 132
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN C 238
source : BC5

19) chain C
residue 137
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 238
source : BC5

20) chain C
residue 53
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 1236
source : BC8

21) chain C
residue 56
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 C 1236
source : BC8

22) chain C
residue 59
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 C 1236
source : BC8

23) chain C
residue 231
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 C 1236
source : BC8

24) chain C
residue 123
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

25) chain C
residue 127
type METAL
ligand
sequence N
description Calcium
source Swiss-Prot : SWS_FT_FI7

26) chain C
residue 132
type METAL
ligand
sequence D
description Calcium
source Swiss-Prot : SWS_FT_FI7

27) chain C
residue 121
type METAL
ligand
sequence E
description Manganese
source Swiss-Prot : SWS_FT_FI8

28) chain C
residue 123
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

29) chain C
residue 132
type METAL
ligand
sequence D
description Manganese
source Swiss-Prot : SWS_FT_FI8

30) chain C
residue 137
type METAL
ligand
sequence H
description Manganese
source Swiss-Prot : SWS_FT_FI8

31) chain C
residue 125
type METAL
ligand
sequence Y
description Calcium; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI9

32) chain C
residue 118-124
type prosite
ligand
sequence VGVEFDT
description Legume lectins beta-chain signature. [LIV]-[STAG]-V-[DEQV]-[FLI]-D-[ST]
source prosite : PS00307

33) chain C
residue 198-207
type prosite
ligand
sequence LPERVKFGFS
description Legume lectins alpha-chain signature. [LIV]-{LA}-[EDQ]-[FYWKR]-V-{VF}-[LIVF]-G-[LF]-[ST]
source prosite : PS00308

34) chain C
residue 41
type binding
ligand MGC: ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE
sequence N
description ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE binding site
source pdb_hetatom : MGC_2dva_C_240

35) chain C
residue 101
type binding
ligand MGC: ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE
sequence I
description ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE binding site
source pdb_hetatom : MGC_2dva_C_240

36) chain C
residue 211-214
type binding
ligand MGC: ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE
sequence SLGG
description ALPHA-METHYL-N-ACETYL-D-GALACTOSAMINE binding site
source pdb_hetatom : MGC_2dva_C_240

37) chain C
residue 80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence D
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

38) chain C
residue 82-83
type binding
ligand GAL: BETA-D-GALACTOSE
sequence AD
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

39) chain C
residue 103-104
type binding
ligand GAL: BETA-D-GALACTOSE
sequence GG
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

40) chain C
residue 125
type binding
ligand GAL: BETA-D-GALACTOSE
sequence Y
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

41) chain C
residue 127
type binding
ligand GAL: BETA-D-GALACTOSE
sequence N
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

42) chain C
residue 129
type binding
ligand GAL: BETA-D-GALACTOSE
sequence E
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

43) chain C
residue 210-211
type binding
ligand GAL: BETA-D-GALACTOSE
sequence GS
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239

44) chain C
residue 213-214
type binding
ligand GAL: BETA-D-GALACTOSE
sequence GG
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_2dva_C_239


Display surface

Download
Links