eF-site ID 2dmb_10-A
PDB Code 2dmb
Model 10
Chain A

click to enlarge
Title Solution structure of the 15th Filamin domain from human Filamin-B
Classification STRUCTURAL PROTEIN
Compound Filamin-B
Source Homo sapiens (Human) (FLNB_HUMAN)
Sequence A:  GSSGSSGTGDASKCLATGPGIASTVKTGEEVGFVVDAKTA
GKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGT
YVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPSG
PSSG
Description (1)  Filamin-B

Display surface

Download
Links