eF-site ID 2dlf-H
PDB Code 2dlf
Chain H

click to enlarge
Title HIGH RESOLUTION CRYSTAL STRUCTURE OF THE FV FRAGMENT FROM AN ANTI-DANSYL SWITCH VARIANT ANTIBODY IGG2A(S) CRYSTALLIZED AT PH 6.75
Classification IMMUNE SYSTEM
Compound PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN))
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence H:  EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQS
PEKGLEWVAEIRNKANNHATYYAESVKGRFTISRDDSKRR
VYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS
Description (1)  PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) CHAIN: L, H)


Functional site

1) chain H
residue 96
type
ligand
sequence Y
description
source : H-1

2) chain H
residue 97
type
ligand
sequence Y
description
source : H-1

3) chain H
residue 98
type
ligand
sequence H
description
source : H-1

4) chain H
residue 27
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 H 402
source : AC2

5) chain H
residue 28
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 H 402
source : AC2

6) chain H
residue 29
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SO4 H 402
source : AC2

7) chain H
residue 30
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 H 402
source : AC2


Display surface

Download
Links