eF-site ID 2csw_11-A
PDB Code 2csw
Model 11
Chain A

click to enlarge
Title Solution structure of the FHA domain of human ubiquitin ligase protein RNF8
Classification LIGASE
Compound Ubiquitin ligase protein RNF8
Source Homo sapiens (Human) (RNF8_HUMAN)
Sequence A:  GSSGSSGVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTV
GRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNK
SLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
EYEVTEEDWETIYPCLSPKSGPSSG
Description (1)  Ubiquitin ligase protein RNF8 (E.C.6.3.2.-)

Display surface

Download
Links