eF-site ID 2cnm-ABC PDB Code 2cnm Chain A, B, C click to enlarge Title RimI - Ribosomal S18 N-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (Cterm-Arg-Arg-Phe-Tyr-Arg-Ala-N-alpha- acetyl-S-CoA). Classification TRANSFERASE Compound MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18 Source (V2H9S5_SALET) Sequence A:  MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERY LNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGL GRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGF NEATIRRNYYPTAQGHEDAIIMALPISMKLH B:  MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERY LNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGL GRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGF NEATIRRNYYPTAQGHEDAIIMALPISMKLH C:  MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERY LNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGL GRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGF NEATIRRNYYPTAQGHEDAIIMALPISMKLH Description (1)  MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18 (E.C.2.3.1.128), 30S RIBOSOMAL PROTEIN S18 Functional site 1) chain A residue 22 type sequence A description BINDING SITE FOR RESIDUE COA D 0 source : AC1 2) chain A residue 23 type sequence H description BINDING SITE FOR RESIDUE COA D 0 source : AC1 3) chain A residue 69 type sequence I description BINDING SITE FOR RESIDUE COA D 0 source : AC1 4) chain A residue 70 type sequence A description BINDING SITE FOR RESIDUE COA D 0 source : AC1 5) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE COA D 0 source : AC1 6) chain A residue 76 type sequence Q description BINDING SITE FOR RESIDUE COA D 0 source : AC1 7) chain A residue 77 type sequence R description BINDING SITE FOR RESIDUE COA D 0 source : AC1 8) chain A residue 78 type sequence R description BINDING SITE FOR RESIDUE COA D 0 source : AC1 9) chain A residue 79 type sequence G description BINDING SITE FOR RESIDUE COA D 0 source : AC1 10) chain A residue 81 type sequence G description BINDING SITE FOR RESIDUE COA D 0 source : AC1 11) chain A residue 82 type sequence R description BINDING SITE FOR RESIDUE COA D 0 source : AC1 12) chain A residue 103 type sequence E description BINDING SITE FOR RESIDUE COA D 0 source : AC1 13) chain A residue 104 type sequence V description BINDING SITE FOR RESIDUE COA D 0 source : AC1 14) chain A residue 108 type sequence N description BINDING SITE FOR RESIDUE COA D 0 source : AC1 15) chain A residue 110 type sequence A description BINDING SITE FOR RESIDUE COA D 0 source : AC1 16) chain A residue 113 type sequence A description BINDING SITE FOR RESIDUE COA D 0 source : AC1 17) chain A residue 114 type sequence L description BINDING SITE FOR RESIDUE COA D 0 source : AC1 18) chain A residue 115 type sequence Y description BINDING SITE FOR RESIDUE COA D 0 source : AC1 19) chain A residue 133 type sequence A description BINDING SITE FOR RESIDUE COA E 0 source : AC2 20) chain A residue 134 type sequence Q description BINDING SITE FOR RESIDUE COA E 0 source : AC2 21) chain B residue 22 type sequence A description BINDING SITE FOR RESIDUE COA E 0 source : AC2 22) chain B residue 23 type sequence H description BINDING SITE FOR RESIDUE COA E 0 source : AC2 23) chain B residue 69 type sequence I description BINDING SITE FOR RESIDUE COA E 0 source : AC2 24) chain B residue 70 type sequence A description BINDING SITE FOR RESIDUE COA E 0 source : AC2 25) chain B residue 71 type sequence V description BINDING SITE FOR RESIDUE COA E 0 source : AC2 26) chain B residue 76 type sequence Q description BINDING SITE FOR RESIDUE COA E 0 source : AC2 27) chain B residue 77 type sequence R description BINDING SITE FOR RESIDUE COA E 0 source : AC2 28) chain B residue 78 type sequence R description BINDING SITE FOR RESIDUE COA E 0 source : AC2 29) chain B residue 79 type sequence G description BINDING SITE FOR RESIDUE COA E 0 source : AC2 30) chain B residue 80 type sequence L description BINDING SITE FOR RESIDUE COA E 0 source : AC2 31) chain B residue 81 type sequence G description BINDING SITE FOR RESIDUE COA E 0 source : AC2 32) chain B residue 82 type sequence R description BINDING SITE FOR RESIDUE COA E 0 source : AC2 33) chain B residue 103 type sequence E description BINDING SITE FOR RESIDUE COA E 0 source : AC2 34) chain B residue 108 type sequence N description BINDING SITE FOR RESIDUE COA E 0 source : AC2 35) chain B residue 110 type sequence A description BINDING SITE FOR RESIDUE COA E 0 source : AC2 36) chain B residue 113 type sequence A description BINDING SITE FOR RESIDUE COA E 0 source : AC2 37) chain B residue 115 type sequence Y description BINDING SITE FOR RESIDUE COA E 0 source : AC2 38) chain C residue 22 type sequence A description BINDING SITE FOR RESIDUE COA F 0 source : AC3 39) chain C residue 23 type sequence H description BINDING SITE FOR RESIDUE COA F 0 source : AC3 40) chain C residue 69 type sequence I description BINDING SITE FOR RESIDUE COA F 0 source : AC3 41) chain C residue 70 type sequence A description BINDING SITE FOR RESIDUE COA F 0 source : AC3 42) chain C residue 71 type sequence V description BINDING SITE FOR RESIDUE COA F 0 source : AC3 43) chain C residue 76 type sequence Q description BINDING SITE FOR RESIDUE COA F 0 source : AC3 44) chain C residue 77 type sequence R description BINDING SITE FOR RESIDUE COA F 0 source : AC3 45) chain C residue 78 type sequence R description BINDING SITE FOR RESIDUE COA F 0 source : AC3 46) chain C residue 79 type sequence G description BINDING SITE FOR RESIDUE COA F 0 source : AC3 47) chain C residue 80 type sequence L description BINDING SITE FOR RESIDUE COA F 0 source : AC3 48) chain C residue 81 type sequence G description BINDING SITE FOR RESIDUE COA F 0 source : AC3 49) chain C residue 82 type sequence R description BINDING SITE FOR RESIDUE COA F 0 source : AC3 50) chain C residue 90 type sequence D description BINDING SITE FOR RESIDUE COA F 0 source : AC3 51) chain C residue 103 type sequence E description BINDING SITE FOR RESIDUE COA F 0 source : AC3 52) chain C residue 108 type sequence N description BINDING SITE FOR RESIDUE COA F 0 source : AC3 53) chain C residue 110 type sequence A description BINDING SITE FOR RESIDUE COA F 0 source : AC3 54) chain C residue 111 type sequence A description BINDING SITE FOR RESIDUE COA F 0 source : AC3 55) chain C residue 114 type sequence L description BINDING SITE FOR RESIDUE COA F 0 source : AC3 56) chain C residue 115 type sequence Y description BINDING SITE FOR RESIDUE COA F 0 source : AC3 57) chain C residue 149 type sequence K description BINDING SITE FOR RESIDUE COA F 0 source : AC3 58) chain A residue 69 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 59) chain A residue 77 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 60) chain A residue 108 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 61) chain B residue 69 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 62) chain B residue 77 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 63) chain B residue 108 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 64) chain C residue 69 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 65) chain C residue 77 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 66) chain C residue 108 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000269|PubMed:18596200 source Swiss-Prot : SWS_FT_FI3 67) chain A residue 115 type ACT_SITE sequence Y description Proton donor => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000305|PubMed:18596200 source Swiss-Prot : SWS_FT_FI2 68) chain B residue 115 type ACT_SITE sequence Y description Proton donor => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000305|PubMed:18596200 source Swiss-Prot : SWS_FT_FI2 69) chain C residue 115 type ACT_SITE sequence Y description Proton donor => ECO:0000255|HAMAP-Rule:MF_02210, ECO:0000305|PubMed:18596200 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links