eF-site ID 2clp-A PDB Code 2clp Chain A click to enlarge Title Crystal structure of human aflatoxin B1 aldehyde reductase member 3 Classification OXIDOREDUCTASE Compound AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3 Source (ARK73_HUMAN) Sequence A:  RPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFV YSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKP DSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRAC HQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVY QGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGK YKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALV EKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILG MSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPN YFR Description Functional site 1) chain A residue 269 type sequence H description BINDING SITE FOR RESIDUE CA A 1362 source : AC1 2) chain A residue 272 type sequence E description BINDING SITE FOR RESIDUE CA A 1362 source : AC1 3) chain A residue 44 type sequence G description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 4) chain A residue 45 type sequence A description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 5) chain A residue 46 type sequence M description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 6) chain A residue 51 type sequence R description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 7) chain A residue 73 type sequence D description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 8) chain A residue 78 type sequence Y description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 9) chain A residue 142 type sequence H description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 10) chain A residue 172 type sequence S description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 11) chain A residue 173 type sequence N description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 12) chain A residue 198 type sequence Q description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 13) chain A residue 226 type sequence F description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 14) chain A residue 227 type sequence N description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 15) chain A residue 228 type sequence P description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 16) chain A residue 229 type sequence L description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 17) chain A residue 230 type sequence A description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 18) chain A residue 231 type sequence G description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 19) chain A residue 232 type sequence G description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 20) chain A residue 235 type sequence T description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 21) chain A residue 237 type sequence K description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 22) chain A residue 238 type sequence Y description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 23) chain A residue 251 type sequence R description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 24) chain A residue 315 type sequence I description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 25) chain A residue 317 type sequence G description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 26) chain A residue 318 type sequence M description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 27) chain A residue 319 type sequence S description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 28) chain A residue 323 type sequence Q description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 29) chain A residue 326 type sequence Q description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 30) chain A residue 327 type sequence N description BINDING SITE FOR RESIDUE NDP A 1361 source : AC5 31) chain A residue 142 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 32) chain A residue 198 type BINDING sequence Q description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 33) chain A residue 261 type BINDING sequence Y description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 34) chain A residue 264 type BINDING sequence R description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 106 type SITE sequence K description Lowers pKa of active site Tyr => ECO:0000250 source Swiss-Prot : SWS_FT_FI4 36) chain A residue 114 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI6 37) chain A residue 78 type ACT_SITE sequence Y description Proton donor => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 73 type BINDING sequence D description BINDING => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 172 type BINDING sequence S description BINDING => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 227 type BINDING sequence N description BINDING => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 251 type BINDING sequence R description BINDING => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 319 type BINDING sequence S description BINDING => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 256 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links