eF-site ID 2cg4-B
PDB Code 2cg4
Chain B

click to enlarge
Title Structure of E.coli AsnC
Classification TRANSCRIPTION
Compound REGULATORY PROTEIN ASNC
Source Escherichia coli (strain K12) (ASNC_ECOLI)
Sequence B:  YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRV
EKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYP
SALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVL
INKIQTIDEIQSTETLIVLQNPIMRTIKP
Description (1)  REGULATORY PROTEIN ASNC


Functional site

1) chain B
residue 58
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A1154
source : AC1

2) chain B
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

3) chain B
residue 101
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

4) chain B
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

5) chain B
residue 103
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

6) chain B
residue 105
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

7) chain B
residue 106
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

8) chain B
residue 128
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

9) chain B
residue 136
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

10) chain B
residue 137
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

11) chain B
residue 138
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

12) chain B
residue 25-44
type DNA_BIND
ligand
sequence YAELAKQFGVSPETIHVRVE
description H-T-H motif (Potential).
source Swiss-Prot : SWS_FT_FI2

13) chain B
residue 24-50
type prosite
ligand
sequence AYAELAKQFGVSPETIHVRVEKMKQAG
description AsnC-type HTH domain signature. [GSTAP]-x(2)-[DNEQA]-[LIVM]-[GSA]-x(2)-[LIVMFYT]-[GAN]-[LIVMST]-[ST]
source prosite : PS00519

14) chain B
residue 100-107
type binding
ligand ASN: ASPARAGINE
sequence YTTGHYSI
description ASPARAGINE binding site
source pdb_hetatom : ASN_2cg4_B_1153


Display surface

Download
Links