eF-site ID 2cg4-AB
PDB Code 2cg4
Chain A, B

click to enlarge
Title Structure of E.coli AsnC
Classification TRANSCRIPTION
Compound REGULATORY PROTEIN ASNC
Source Escherichia coli (strain K12) (ASNC_ECOLI)
Sequence A:  YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRV
EKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYP
SALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVL
INKIQTIDEIQSTETLIVLQNPIMRTIKP
B:  YLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRV
EKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYP
SALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVL
INKIQTIDEIQSTETLIVLQNPIMRTIKP
Description (1)  REGULATORY PROTEIN ASNC


Functional site

1) chain A
residue 58
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A1154
source : AC1

2) chain B
residue 58
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A1154
source : AC1

3) chain A
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

4) chain A
residue 101
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

5) chain A
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

6) chain A
residue 103
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

7) chain A
residue 105
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

8) chain A
residue 106
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

9) chain A
residue 128
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

10) chain A
residue 136
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

11) chain A
residue 137
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

12) chain A
residue 138
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN A1153
source : AC2

13) chain B
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

14) chain B
residue 101
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

15) chain B
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

16) chain B
residue 103
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

17) chain B
residue 105
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

18) chain B
residue 106
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

19) chain B
residue 128
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

20) chain B
residue 136
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

21) chain B
residue 137
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

22) chain B
residue 138
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN B1153
source : AC3

23) chain A
residue 25-44
type DNA_BIND
ligand
sequence YAELAKQFGVSPETIHVRVE
description H-T-H motif (Potential).
source Swiss-Prot : SWS_FT_FI1

24) chain B
residue 25-44
type DNA_BIND
ligand
sequence YAELAKQFGVSPETIHVRVE
description H-T-H motif (Potential).
source Swiss-Prot : SWS_FT_FI2

25) chain A
residue 24-50
type prosite
ligand
sequence AYAELAKQFGVSPETIHVRVEKMKQAG
description AsnC-type HTH domain signature. [GSTAP]-x(2)-[DNEQA]-[LIVM]-[GSA]-x(2)-[LIVMFYT]-[GAN]-[LIVMST]-[ST]
source prosite : PS00519

26) chain B
residue 24-50
type prosite
ligand
sequence AYAELAKQFGVSPETIHVRVEKMKQAG
description AsnC-type HTH domain signature. [GSTAP]-x(2)-[DNEQA]-[LIVM]-[GSA]-x(2)-[LIVMFYT]-[GAN]-[LIVMST]-[ST]
source prosite : PS00519

27) chain A
residue 100-107
type binding
ligand ASN: ASPARAGINE
sequence YTTGHYSI
description ASPARAGINE binding site
source pdb_hetatom : ASN_2cg4_A_1153

28) chain B
residue 100-107
type binding
ligand ASN: ASPARAGINE
sequence YTTGHYSI
description ASPARAGINE binding site
source pdb_hetatom : ASN_2cg4_B_1153


Display surface

Download
Links