eF-site ID 2ce1-A PDB Code 2ce1 Chain A click to enlarge Title Structure of reduced Arabidopsis thaliana cytochrome 6A Classification ELECTRON TRANSFER Compound CYTOCHROME C6 Source Arabidopsis thaliana (Mouse-ear cress) (CYC6_ARATH) Sequence A:  LDIQRGATLFNRACAACHDTGGNIIQPGATLFTKDLERNG VDTEEEIYRVTYFGKGRMPGFGEKCTPRGQCTFGPRLQDE EIKLLAEFVKFQADQGWPTV Description Functional site 1) chain A residue 15 type sequence A description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 2) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 3) chain A residue 19 type sequence C description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 4) chain A residue 20 type sequence H description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 5) chain A residue 25 type sequence N description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 6) chain A residue 28 type sequence Q description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 7) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 8) chain A residue 32 type sequence T description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 9) chain A residue 33 type sequence L description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 10) chain A residue 37 type sequence D description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 11) chain A residue 41 type sequence N description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 12) chain A residue 43 type sequence V description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 13) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 14) chain A residue 53 type sequence T description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 15) chain A residue 57 type sequence K description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 16) chain A residue 60 type sequence M description BINDING SITE FOR RESIDUE HEC A1102 source : AC1 17) chain A residue 28 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 18) chain A residue 16 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:16777100, ECO:0000269|PubMed:16815443, ECO:0000269|PubMed:17625855 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 19 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:16777100, ECO:0000269|PubMed:16815443, ECO:0000269|PubMed:17625855 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 20 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 21) chain A residue 60 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links