eF-site ID 2c4g-A PDB Code 2c4g Chain A click to enlarge Title STRUCTURE OF CDK2-CYCLIN A WITH PHA-533514 Classification TRANSFERASE Compound CELL DIVISION PROTEIN KINASE 2 Source (CCNA2_HUMAN) Sequence A:  PLVDMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR LDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKL YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLA FCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPV RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEM VTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDY KPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS AKAALAHPFFQDVTKPVPHLR Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2 Functional site 1) chain A residue 256 type ligand sequence D description BINDING SITE FOR RESIDUE SO4 A 305 source : AC1 2) chain A residue 257 type ligand sequence E description BINDING SITE FOR RESIDUE SO4 A 305 source : AC1 3) chain A residue 260 type ligand sequence R description BINDING SITE FOR RESIDUE SO4 A 305 source : AC1 4) chain A residue 10 type ligand sequence I description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 5) chain A residue 31 type ligand sequence A description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 6) chain A residue 33 type ligand sequence K description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 7) chain A residue 80 type ligand sequence F description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 8) chain A residue 81 type ligand sequence E description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 9) chain A residue 82 type ligand sequence F description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 10) chain A residue 83 type ligand sequence L description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 11) chain A residue 84 type ligand sequence H description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 12) chain A residue 85 type ligand sequence Q description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 13) chain A residue 86 type ligand sequence D description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 14) chain A residue 89 type ligand sequence K description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 15) chain A residue 134 type ligand sequence L description BINDING SITE FOR RESIDUE 514 A 306 source : AC3 16) chain A residue 149 type catalytic ligand sequence A description Mapped from 2phk to 2c4g using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 17) chain A residue 151 type catalytic ligand sequence A description Mapped from 2phk to 2c4g using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 18) chain A residue 10-33 type prosite ligand sequence IGEGTYGVVYKARNKLTGEVVALK description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K. source prosite : PS00107 19) chain A residue 123-135 type prosite ligand sequence VLHRDLKPQNLLI description Serine/Threonine protein kinases active-site signature.[LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3). source prosite : PS00108 20) chain A residue 131 type catalytic ligand sequence Q description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 21) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 22) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 23) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 24) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 25) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 26) chain A residue 165 type catalytic ligand sequence T description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 27) chain A residue 127 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA7 28) chain A residue 129 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA7 29) chain A residue 132 type catalytic ligand sequence N description Annotated By Reference To The Literature 1ir3 source CSA : CSA7

Display surface Download Links