eF-site ID 2c0z-A PDB Code 2c0z Chain A click to enlarge Title The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides Classification ISOMERASE Compound NOVW Source Streptomyces niveus (Streptomyces spheroides) (Q9L9E5_STRSH) Sequence A:  SGLVPRGSHMRLRPLGIEGVWEITPEQRADPRGVFLDWYH VDRFAEAIGRPLRLAQANLSVSVRGVVRGIHFVDVPPGQA KYVTCVRGAVFDVVVDLRVGSPTYGCWEGTRLDDVSRRAV YLSEGIGHGFCAISDEATLCYLSSGTYDPATEHGVHPLDP ELAIDWPTGTPLLSPRDQDALLLAEARDAGLLPTYATCQ Description Functional site 1) chain A residue 19 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1191 source : AC1 2) chain A residue 165 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1191 source : AC1 3) chain A residue 167 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1191 source : AC1 4) chain A residue -1 type sequence S description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 5) chain A residue -3 type sequence R description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 6) chain A residue 15 type sequence T description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 7) chain A residue 16 type sequence P description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 8) chain A residue 107 type sequence S description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 9) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE EDO A 1192 source : AC2 10) chain A residue 105 type sequence D description BINDING SITE FOR RESIDUE EDO A 1193 source : AC3 11) chain A residue 108 type sequence R description BINDING SITE FOR RESIDUE EDO A 1193 source : AC3 12) chain A residue 5 type sequence P description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 13) chain A residue 8 type sequence I description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 14) chain A residue 9 type sequence E description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 15) chain A residue 10 type sequence G description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 16) chain A residue 11 type sequence V description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 17) chain A residue 12 type sequence W description BINDING SITE FOR RESIDUE EDO A 1194 source : AC4 18) chain A residue 23 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 28 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 47 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 21) chain A residue 59 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 22) chain A residue 72 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 23) chain A residue 119 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 143 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 25) chain A residue 167 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 62 type ACT_SITE sequence H description Proton acceptor => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 132 type ACT_SITE sequence Y description Proton donor => ECO:0000250|UniProtKB:Q9HU21 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 138 type SITE sequence Y description Participates in a stacking interaction with the thymidine ring of dTDP-4-oxo-6-deoxyglucose => ECO:0000250|UniProtKB:Q5SFD1 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links