eF-site ID 2c0x-A
PDB Code 2c0x
Chain A

click to enlarge
Title MOLECULAR STRUCTURE OF FD FILAMENTOUS BACTERIOPHAGE REFINED WITH RESPECT TO X-RAY FIBRE DIFFRACTION AND SOLID-STATE NMR DATA
Classification VIRAL PROTEIN
Compound COAT PROTEIN B
Source Enterobacteria phage fd (Bacteriophage fd) (COATB_BPFD)
Sequence A:  AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIK
LFKKFTSKAS
Description (1)  COAT PROTEIN B


Functional site

1) chain A
residue 22-42
type TRANSMEM
ligand
sequence IGYAWAMVVVIVGATIGIKLF
description Helical. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links