eF-site ID 2bwh-A PDB Code 2bwh Chain A click to enlarge Title Laue Structure of a Short Lived State of L29W Myoglobin Classification OXYGEN TRANSPORT Compound Myoglobin Source (MYG_PHYCD) Sequence A:  VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETL EKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP GNFGADAQGAMNKALELFRKDIAAKYKELGYQG Description (1)  MYOGLOBIN Functional site 1) chain A residue 29 type sequence W description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 2) chain A residue 43 type sequence F description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 3) chain A residue 45 type sequence R description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 4) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 5) chain A residue 89 type sequence L description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 6) chain A residue 92 type sequence S description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 7) chain A residue 93 type sequence H description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 8) chain A residue 97 type sequence H description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 9) chain A residue 99 type sequence I description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 10) chain A residue 103 type sequence Y description BINDING SITE FOR RESIDUE HEM A1154 source : AC1 11) chain A residue 89 type sequence L description BINDING SITE FOR RESIDUE CMO A1155 source : AC2 12) chain A residue 93 type sequence H description BINDING SITE FOR RESIDUE CMO A1155 source : AC2 13) chain A residue 138 type sequence F description BINDING SITE FOR RESIDUE CMO A1155 source : AC2 14) chain A residue 93 type BINDING sequence H description proximal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959, ECO:0007744|PDB:4MBN, ECO:0007744|PDB:5MBN source Swiss-Prot : SWS_FT_FI2 15) chain A residue 3 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q9QZ76 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 67 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P04247 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 64 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:7463482, ECO:0007744|PDB:1MBO source Swiss-Prot : SWS_FT_FI1

Display surface Download Links