eF-site ID 2bw9-M PDB Code 2bw9 Chain M click to enlarge Title Laue Structure of L29W MbCO Classification OXYGEN TRANSPORT Compound MYOGLOBIN Source (MYG_PHYCA) Sequence M:  VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETL EKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP GNFGADAQGAMNKALELFRKDIAAKYKELGYQG Description Functional site 1) chain M residue 43 type sequence F description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 2) chain M residue 45 type sequence R description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 3) chain M residue 64 type sequence H description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 4) chain M residue 89 type sequence L description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 5) chain M residue 92 type sequence S description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 6) chain M residue 93 type sequence H description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 7) chain M residue 97 type sequence H description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 8) chain M residue 99 type sequence I description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 9) chain M residue 103 type sequence Y description BINDING SITE FOR RESIDUE HEM M 154 source : AC1 10) chain M residue 29 type sequence W description BINDING SITE FOR RESIDUE CMO M 155 source : AC2 11) chain M residue 43 type sequence F description BINDING SITE FOR RESIDUE CMO M 155 source : AC2 12) chain M residue 64 type sequence H description BINDING SITE FOR RESIDUE CMO M 155 source : AC2 13) chain M residue 68 type sequence V description BINDING SITE FOR RESIDUE CMO M 155 source : AC2 14) chain M residue 4 type MOD_RES sequence E description Phosphoserine => ECO:0000250|UniProtKB:Q9QZ76 source Swiss-Prot : SWS_FT_FI3 15) chain M residue 68 type MOD_RES sequence V description Phosphothreonine => ECO:0000250|UniProtKB:P04247 source Swiss-Prot : SWS_FT_FI4 16) chain M residue 65 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:7463482, ECO:0007744|PDB:1MBO source Swiss-Prot : SWS_FT_FI1 17) chain M residue 94 type BINDING sequence A description proximal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959, ECO:0007744|PDB:4MBN, ECO:0007744|PDB:5MBN source Swiss-Prot : SWS_FT_FI2

Display surface Download Links