eF-site ID 2bug_13-A
PDB Code 2bug
Model 13
Chain A

click to enlarge
Title Solution structure of the TPR domain from Protein phosphatase 5 in complex with Hsp90 derived peptide
Classification HYDROLASE
Compound SERINE/THREONINE PROTEIN PHOSPHATASE 5
Source Homo sapiens (Human) (Q9H2A1_HUMAN)
Sequence A:  TDPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIE
LNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYI
KGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKY
QECNKIVKQKA
Description (1)  SERINE/THREONINE PROTEIN PHOSPHATASE 5 (E.C.3.1.3.16), HSP90

Display surface

Download
Links