eF-site ID 2bpm-D
PDB Code 2bpm
Chain D

click to enlarge
Title STRUCTURE OF CDK2-CYCLIN A WITH PHA-630529
Classification TRANSFERASE
Compound CELL DIVISION PROTEIN KINASE 2
Source (CCNA2_HUMAN)
Sequence D:  YHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDW
LVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVG
TAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHL
VLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLG
ELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLI
RKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSK
YHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2


Functional site

1) chain D
residue 410
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 D1433
source : AC2

2) chain D
residue 414
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 D1433
source : AC2

3) chain D
residue 423
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SO4 D1433
source : AC2

4) chain D
residue 211-242
type prosite
ligand
sequence RAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
description Cyclins signature. R-x(2)-[LIVMSA]-x(2)-[FYWS]-[LIVM]-x(8)-[LIVMFC]-x(4)-[LIVMFYA]-x(2)
source prosite : PS00292


Display surface

Download
Links